Catalogue Products
Custom Services
CHEMPEPTIDE
- Your Reliable Research Partner
- Contact Us: info@chempeptide.com
- service@chempeptide.org
Flag, 3 X FLAG, LL-37 and MOG 35-55
• HPLC & MS analysis data for each peptide, 100% quality guaranteed.
• The purity of every peptide is >95% or >98% or higher
• All peptides are shipped in lyophilized powder
• We offer reasonable discount for large order. Please email us for a quote
| Cat No. | Size | Price (USD) | Delivery time | |||
| CP-100051-1 | 5 mg | Inquiry | 1~2 days | |||
| CP-100051-2 | 10 mg | Inquiry | 1~2 days | |||
|
|
||||||
| Purity: | >95% or >98% | |||||
| Sequence: | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | |||||
| CAS No.: | 154947-66-7 | Formula: | C205H340N60O53 | |||
| M.W.: | 4493.33 | Counter Ion: | TFA | |||
| Appearance: | Lyophilized white powder | Reconstitution: | Water | |||
| Storage: | Power: -20oC(1 year) or -80oC(1~2 years) | |||||
| Shipping: | All peptides will be shipped as lyophilized powder with desiccant at room temperature. | |||||
| Cat No. | Size | Price (USD) | Delivery time | |||
| CP-100061-1 | 5 mg | Inquiry | 1~2 days | |||
| CP-100061-2 | 10 mg | Inquiry | 1~2 days | |||
|
|
||||||
| Purity: | >98% | |||||
| Sequence: | MEVGWYRSPFSRVVHLYRNGK | |||||
| CAS No.: | 149635-73-4 | Formula: | C118H177N35O29S | |||
| M.W.: | 2581.99 | Counter Ion: | TFA | |||
| Appearance: | Lyophilized white powder | Reconstitution: | Water | |||
| Storage: | Power: -20oC(1 year) or -80oC(1~2 years) | |||||
| Shipping: | All peptides will be shipped as lyophilized powder with desiccant at room temperature. | |||||
| Cat No. | Size | Price (USD) | Delivery time | |||
| CP-100071-1 | 5 mg | Inquiry | 1~2 days | |||
| CP-100071-2 | 10 mg | Inquiry | 1~2 days | |||
|
|
||||||
| Purity: | >98% | |||||
| Sequence: | MDYKDHDGDYKDHDIDYKDDDDK | |||||
| CAS No.: | N/A | Formula: | C120H169N31O49S | |||
| M.W.: | 2861.91 | Counter Ion: | TFA | |||
| Appearance: | Lyophilized white powder | Reconstitution: | Water | |||
| Storage: | Power: -20oC(1 year) or -80oC(1~2 years) | |||||
| Shipping: | All peptides will be shipped as lyophilized powder with desiccant at room temperature. | |||||
| Cat No. | Size | Price (USD) | Delivery time | |||
| CP-100081-1 | 5 mg | Inquiry | 1~2 days | |||
| CP-100081-2 | 10 mg | Inquiry | 1~2 days | |||
|
|
||||||
| Purity: | >98% | |||||
| Sequence: | DYKDDDDK | |||||
| CAS No.: | 98849-88-8 | Formula: | C41H60N10O20 | |||
| M.W.: | 1012.98 | Counter Ion: | TFA | |||
| Appearance: | Lyophilized white powder | Reconstitution: | Water | |||
| Storage: | Power: -20oC(1 year) or -80oC(1~2 years) | |||||
| Shipping: | All peptides will be shipped as lyophilized powder with desiccant at room temperature. | |||||
Copyright © 2006-2020 Chempeptide Limited. All Rights Reserved